DPCfam | MC124892
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Residues in low-complexity regions (%) | 17.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.65 |
| Average transmembrane regions | 1.01 |
| Dominant Pfam architecture(s) | PF02553 |
| Sequences matching dominant architecture (%) | 96.58 |
| Average overlap percent | 70.47 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A0IQG3 | 16-102 | 87 | NIFLGILVVVIAVAPLIFAKGAEFAGSDDQAEEAITQVDKNYKPWFSPVWEPPSGEIESLLFALQAAIGAGIVGYYFGYAKGKKK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8XNY9-F1 | 11-93 | 97.65 | 88.80 | View in AlphaFoldDB ↗ |