DPCfam | MC124870
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 58 ± 8 aa |
| Residues in low-complexity regions (%) | 2.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 69.74 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T1J3V2 | 410-469 | 60 | NLPPVKRWRLRGDWSDTGPNARPEGEVAGGQQRPPSVQSILIRRMSDVLTRILNEPSSRR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58WW2-F1 | 305-356 | 100.00 | 44.30 | View in AlphaFoldDB ↗ |