DPCfam | MC124810
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 367 ± 39 aa |
| Residues in low-complexity regions (%) | 2.1 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 15.78 |
| Average transmembrane regions | 0.14 |
| Dominant Pfam architecture(s) | PF01753 |
| Sequences matching dominant architecture (%) | 93.53 |
| Average overlap percent | 11.0 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J0WRT9 | 51-452 | 402 | FSPESKPQLDILLVDCHDFFGACTRMLSAPRHADDLPRLQRLLEGTVARCPNTAWHEYTKEHVGRELESVVFSLYRCLTHVIGAG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A4HSS1-F1 | 114-166 | 13.90 | 85.84 | View in AlphaFoldDB ↗ |