DPCfam | MC124783
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 501 |
|---|---|
| Mean domain length (aa) | 86 ± 14 aa |
| Residues in low-complexity regions (%) | 0.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.48 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02516 |
| Sequences matching dominant architecture (%) | 47.86 |
| Average overlap percent | 9.02 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W4ZHW5 | 353-428 | 76 | REAYYWLRKNTDDHARVMSWWDYGYQIAGMGNKTTLVDNNTWNNSHIALVGKAMSSNETAAYKIMRDLSVDYVLVI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7MIW7-F1 | 538-619 | 96.47 | 94.53 | View in AlphaFoldDB ↗ |