DPCfam | MC124428
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Residues in low-complexity regions (%) | 1.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.65 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08416 |
| Sequences matching dominant architecture (%) | 1.71 |
| Average overlap percent | 46.74 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007044CE0 | 132-207 | 76 | LIVSTCGGPDIARSVSSPLLSRDAVGFLRGHLVPKEMALWESLGETWTRPRSEWPREPQVLPYMPKFHSGWEPPLD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1M3L7-F1 | 368-441 | 98.67 | 90.49 | View in AlphaFoldDB ↗ |