DPCfam | MC124408
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 65 ± 10 aa |
| Residues in low-complexity regions (%) | 1.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.9 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF15632 |
| Sequences matching dominant architecture (%) | 50.0 |
| Average overlap percent | 23.2 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S8L943 | 247-316 | 69 | LTIQCIVDNRGKVYFIEINPRFGGGVPLSFEAGGDYGKYLGDIKNNINIETIDDFKELTMLRYDEAIYV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B8D1H3-F1 | 283-342 | 84.29 | 94.41 | View in AlphaFoldDB ↗ |