DPCfam | MC12437
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 168 ± 19 aa |
| Residues in low-complexity regions (%) | 5.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.59 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14435 |
| Sequences matching dominant architecture (%) | 98.78 |
| Average overlap percent | 91.81 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A101U7H5 | 1-176 | 176 | MITRKDLETLYSAEVIVTLSPEESQKLRLLQDDSRFLAEIGLPRHAPPFFTTEVSGGPEFLLPIDIPTSSGGIHREVIIGGPPGD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q80WE6-F1 | 13-90 | 40.24 | 45.28 | View in AlphaFoldDB ↗ |