DPCfam | MC12428
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 69 ± 8 aa |
| Residues in low-complexity regions (%) | 0.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.82 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12872 |
| Sequences matching dominant architecture (%) | 95.45 |
| Average overlap percent | 85.02 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A014MVP3 | 163-233 | 71 | EYLRSVVEVTSDDNGWASLSNVGGLTVKRLPDFDARTYGYAKLSELIRSLDAFELCSSHIEGKQAVLYVRE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F432-F1 | 169-235 | 92.86 | 92.93 | View in AlphaFoldDB ↗ |