DPCfam | MC124045
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 337 ± 73 aa |
| Residues in low-complexity regions (%) | 1.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.53 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF03543 |
| Sequences matching dominant architecture (%) | 8.11 |
| Average overlap percent | 51.61 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0W0TIJ8 | 15-418 | 404 | VDLSQNQVIENLNQYLQWHNLPLKMNSDGVCNGLAIIYAKYILEGKKGEFWKLMDYVAGKKISQNEEESVNQFVAEVILSFKPDK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-G5E8K5-F1 | 205-337 | 37.04 | 93.94 | View in AlphaFoldDB ↗ |