DPCfam | MC123738
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 73 ± 6 aa |
| Residues in low-complexity regions (%) | 10.52 |
| Residues in coiled-coil regions (%) | 43.78 |
| Predicted disordered residues (%) | 52.48 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004B4A395 | 1-72 | 72 | MNKARRAKLGKIHDEIGTIIEQVEFLRDEEEESFENLPEGIQGSEKGEKMESNISDLEELTDLLYEAKDKID... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O33084-F1 | 18-69 | 72.22 | 87.41 | View in AlphaFoldDB ↗ |