DPCfam | MC123529
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 127 ± 11 aa |
| Residues in low-complexity regions (%) | 2.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 5.34 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12686 |
| Sequences matching dominant architecture (%) | 46.88 |
| Average overlap percent | 44.87 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| L0WFE7 | 68-212 | 145 | DFELLKKSLRLQKSAKEIKLKHIGKGSFECILKSEKLNTLLQWLLDNGFYIHYFSLNVLYWSIVDIVDSVIENLNHVERQFFIQA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O42144-F1 | 45-82 | 28.12 | 71.46 | View in AlphaFoldDB ↗ |