DPCfam | MC123495
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 98 ± 13 aa |
| Residues in low-complexity regions (%) | 3.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.54 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12138 |
| Sequences matching dominant architecture (%) | 88.76 |
| Average overlap percent | 41.17 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1T3NQN3 | 212-297 | 86 | YENAADIQVTFEGSYADYQAFTPPQWELDADPAKFWHLIYETTEAQMPSAVAQSKQKNAGTVYVTPDQLDPNPWDSLPGSSYWSS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P11113-F1 | 222-325 | 96.94 | 84.96 | View in AlphaFoldDB ↗ |