DPCfam | MC12346
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 100 ± 7 aa |
| Residues in low-complexity regions (%) | 6.77 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 46.07 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F6PP25 | 1121-1225 | 105 | GSFRVFASGPRRQDDSLSSAEHAVKYNPMFESDTTGCEHSSRTYPRLTSYSSTSGETSTDFSSEEIRHIYENSELSKEEIQDRIR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IE69-F1 | 336-428 | 96.84 | 54.46 | View in AlphaFoldDB ↗ |