DPCfam | MC123358
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 154 ± 27 aa |
| Residues in low-complexity regions (%) | 1.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.68 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05903 |
| Sequences matching dominant architecture (%) | 10.91 |
| Average overlap percent | 69.39 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00084B8CDD | 66-204 | 139 | AYMIPVSQFLQMMHQLTDPSDTVLRVQRFQTAVEGVPIIPTAMFNHQFVVFETQGCWWWSIEKNAEGLTLQRSRDVKAVRRRYRQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4DC70-F1 | 32-120 | 59.46 | 84.83 | View in AlphaFoldDB ↗ |