DPCfam | MC12333
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Residues in low-complexity regions (%) | 1.19 |
| Residues in coiled-coil regions (%) | 0.89 |
| Predicted disordered residues (%) | 32.54 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18148 |
| Sequences matching dominant architecture (%) | 91.11 |
| Average overlap percent | 81.52 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B4JJV4 | 296-365 | 70 | LRNKQRHALEDYEAEALASLHKNLKGKWDFISMQAEEQVRLAKERKKGEKIVGDSQERAYWRVHRPPPGQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9Z2H1-F1 | 103-188 | 98.88 | 92.10 | View in AlphaFoldDB ↗ |