DPCfam | MC123303
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 117 ± 11 aa |
| Residues in low-complexity regions (%) | 1.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.3 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01261 |
| Sequences matching dominant architecture (%) | 94.64 |
| Average overlap percent | 41.64 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S3QVJ6 | 1-104 | 104 | MKILLSSGSLYKDPLEKCFYVAQQAGFDGVEVVLNDFYFLSDIDERLAELSKILSIIAFHAPFMVESSGERVKSLLRSIELALEL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P54581-F1 | 5-123 | 99.17 | 93.67 | View in AlphaFoldDB ↗ |