DPCfam | MC122987
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 61 ± 7 aa |
| Residues in low-complexity regions (%) | 4.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 0.64 |
| Average transmembrane regions | 0.94 |
| Dominant Pfam architecture(s) | PF01578 |
| Sequences matching dominant architecture (%) | 93.05 |
| Average overlap percent | 8.26 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G3QBA9 | 53-112 | 60 | ASILILLYYFITFDYRFVYVYGNSSRDLPLIYRIAAVWAGKEGSFLLWLFFLNAFGIIII... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I3N2-F1 | 47-108 | 100.00 | 96.77 | View in AlphaFoldDB ↗ |