DPCfam | MC122721
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 722 ± 73 aa |
| Residues in low-complexity regions (%) | 3.82 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.73 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF12657- PF12660 |
| Sequences matching dominant architecture (%) | 72.0 |
| Average overlap percent | 97.52 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| O13650 | 55-641 | 587 | DDVEDELPNCQMLAPNELRLGDLTPSVISRYVVWSPTGLADNYDPLLTVLTNRHRVYFFSSSSRVLHQKWTCVAQMSTHLPSDPL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O13650-F1 | 16-670 | 99.46 | 87.38 | View in AlphaFoldDB ↗ |