DPCfam | MC122669
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 492 ± 108 aa |
| Residues in low-complexity regions (%) | 5.99 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 32.74 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000994D981 | 46-643 | 598 | SDSGESQPKRKKGEIRMIWHPSGVEERVNCKKVHLADRTLMPGDVVRRMIKGKDTQRGYCRDVELTACVQVIGTKQILTDIKSED... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7N2S7-F1 | 146-687 | 100.00 | 71.47 | View in AlphaFoldDB ↗ |