DPCfam | MC122610
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 314 ± 69 aa |
| Residues in low-complexity regions (%) | 1.08 |
| Residues in coiled-coil regions (%) | 0.16 |
| Predicted disordered residues (%) | 14.68 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF06918 |
| Sequences matching dominant architecture (%) | 11.32 |
| Average overlap percent | 10.19 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| U9U8U1 | 1-162 | 161 | MVTCTILDNILNIRKADFYYTTILYPGVENYETLQNVMEPIISKLHNLVINGLIDPNGTKWKIEPYFSSTKKDIGNRDKIHKIEK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9XWD9-F1 | 337-547 | 53.25 | 89.72 | View in AlphaFoldDB ↗ |