DPCfam | MC122488
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 122 ± 11 aa |
| Residues in low-complexity regions (%) | 2.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.19 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A1VM05 | 161-286 | 126 | GVASPASVYPFYENATLAAWGQTPAEALEDSGRIWSGFSQAAQANASAWSRQALAPEDITAITPANRLIAWPYTVRVIANPQVNQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CXW9-F1 | 168-290 | 98.37 | 97.57 | View in AlphaFoldDB ↗ |