DPCfam | MC122472
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 113 ± 14 aa |
| Residues in low-complexity regions (%) | 6.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.29 |
| Average transmembrane regions | 2.5 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009FC7B2B | 142-244 | 103 | STARGPAVAARVGIALGVSITVCFLTGLISHWIQHPPTWFYWPAHPVWLYRVTQGTHVISGVIAIPLLLVKLWAVYPKLFARPLI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0FA07-F1 | 21-132 | 97.39 | 92.76 | View in AlphaFoldDB ↗ |