DPCfam | MC122197
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 331 |
|---|---|
| Mean domain length (aa) | 253 ± 41 aa |
| Residues in low-complexity regions (%) | 3.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.19 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | PF13934 |
| Sequences matching dominant architecture (%) | 97.21 |
| Average overlap percent | 79.58 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B4MAQ3 | 728-951 | 224 | SEQDGLYPPRTLQSLMRLMLLPDAKLDHKHELMLYVLHDVDQLLVPKRKRPLYQDFAMAFGIAEPLLKCARSFWFLDKGDYEQTI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PWR6-F1 | 29-298 | 94.09 | 88.64 | View in AlphaFoldDB ↗ |