DPCfam | MC122092
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 173 ± 18 aa |
| Residues in low-complexity regions (%) | 1.27 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.66 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF00083 |
| Sequences matching dominant architecture (%) | 0.45 |
| Average overlap percent | 58.82 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D4AVP0 | 19-186 | 168 | FDWGYLIQPDKSPSPRLEQLCLGLAGVISELDPSSSTKELTPEKLAAFYRAVGGNYDSLFLNTPSASLSFIYQSLGCFHTLQPTK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1D0H2-F1 | 224-391 | 97.70 | 94.77 | View in AlphaFoldDB ↗ |