DPCfam | MC12194
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 97 ± 13 aa |
| Residues in low-complexity regions (%) | 1.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.1 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05593 |
| Sequences matching dominant architecture (%) | 3.33 |
| Average overlap percent | 16.91 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q3JM82 | 184-294 | 111 | YSLAGQPLSNQQQFLRDDRLDSDWAGDDPAAWGRDLLPDTYTSRWAYDAYGREIERTDARGNLQRLHYNIAGQLAASDLRLDGQT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B6A882-F1 | 192-295 | 100.00 | 93.25 | View in AlphaFoldDB ↗ |