DPCfam | MC121823
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 170 ± 28 aa |
| Residues in low-complexity regions (%) | 20.89 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 50.95 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF15371 |
| Sequences matching dominant architecture (%) | 88.64 |
| Average overlap percent | 42.79 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G1T0S5 | 67-239 | 173 | ATRRRKGGTFRGWRPHRREAEERRKREKERRKLSYILKSFVSPVSCSSLGHHHGSTPFRHMLCPDLSCEVCNRTTAEIQQLLLQG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0C874-F1 | 71-261 | 99.47 | 44.88 | View in AlphaFoldDB ↗ |