DPCfam | MC121776
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 88 ± 10 aa |
| Residues in low-complexity regions (%) | 1.6 |
| Residues in coiled-coil regions (%) | 2.31 |
| Predicted disordered residues (%) | 19.61 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T2M874 | 836-914 | 79 | YIKKINRNGVKKMCQNIFTIQQELANITSRRDLNLDMARKYFELLNLTPEEILNTILEQGTFCKEQDYSNALELLSRSE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O35382-F1 | 866-955 | 98.89 | 90.07 | View in AlphaFoldDB ↗ |