DPCfam | MC121691
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 227 ± 22 aa |
| Residues in low-complexity regions (%) | 3.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.87 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00413 |
| Sequences matching dominant architecture (%) | 9.86 |
| Average overlap percent | 25.87 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00046FDB54 | 49-270 | 222 | GSFNHNLGPGASAHDFLASDTYTQLVVEIQYMDGYKPTPDAVSQLKTFLGNRLNKPSGISFIYTQIAPGGKSTYTLDDIAKMEEN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P22796-F1 | 15-185 | 73.36 | 98.32 | View in AlphaFoldDB ↗ |