DPCfam | MC121182
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 57 ± 6 aa |
| Residues in low-complexity regions (%) | 3.36 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 45.94 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00240 |
| Sequences matching dominant architecture (%) | 72.31 |
| Average overlap percent | 20.73 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A059A7Y2 | 21-83 | 63 | NEIDWEMRPCGMLVQRREEEEEGDAAGCDGAGGNGPPVKINVSYGSSQHEIFVPSRSTFGEMK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1K0D4-F1 | 16-72 | 98.33 | 78.62 | View in AlphaFoldDB ↗ |