DPCfam | MC121157
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 56 ± 4 aa |
| Residues in low-complexity regions (%) | 18.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 0.92 |
| Average transmembrane regions | 1.27 |
| Dominant Pfam architecture(s) | PF09991 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 14.27 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009DBF2A1 | 2-62 | 61 | LKNTRQLTEGAVLLAAFAIILLLTLYVPFLGAIIIFFLPLPFILFTAKYNFKGILVFLAAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P37485-F1 | 1-55 | 100.00 | 92.02 | View in AlphaFoldDB ↗ |