DPCfam | MC121132
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 69 ± 11 aa |
| Residues in low-complexity regions (%) | 9.57 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.3 |
| Average transmembrane regions | 1.46 |
| Dominant Pfam architecture(s) | PF09490 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 32.27 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V5X843 | 176-242 | 67 | STVAATVGYLVAVTLLASVLPSFDETPHGFPADVLADFRLASLTNQALLWLVIGSTFACLLPRALRT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X8FCA8-F1 | 175-240 | 94.29 | 96.27 | View in AlphaFoldDB ↗ |