DPCfam | MC12097
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 96 ± 8 aa |
| Residues in low-complexity regions (%) | 17.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.28 |
| Average transmembrane regions | 0.98 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1N2BDB5 | 1-99 | 99 | MSPRVFIGIVGAILLGVGISLAWYGTSVTAAGRTIECGTIRHPDTPGSWEAHMKSRQSDPTPTDYRALCAEKRETVKFFMFGLAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P96266-F1 | 27-120 | 98.06 | 77.67 | View in AlphaFoldDB ↗ |