DPCfam | MC12096
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 401 |
|---|---|
| Mean domain length (aa) | 112 ± 18 aa |
| Residues in low-complexity regions (%) | 5.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.01 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF05786 |
| Sequences matching dominant architecture (%) | 97.09 |
| Average overlap percent | 43.05 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00094E2CB9 | 580-684 | 105 | DNLVEAPEMVEQIFTKYATKAKKMNMAKLKEFTWCILTGKEIFNPSAKVLPIHFSKMYSDLPKILPENMANELSCHLSFVALLHL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D4A8M7-F1 | 611-728 | 99.16 | 74.10 | View in AlphaFoldDB ↗ |