DPCfam | MC120920
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 94 ± 9 aa |
| Residues in low-complexity regions (%) | 2.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.3 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01593 |
| Sequences matching dominant architecture (%) | 98.59 |
| Average overlap percent | 24.67 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00073FCA94 | 72-174 | 103 | LDMVSELGLEGEVLPVLASHEASKNRFLYVGGQLHRMPSGVGGLVRTVPPFSRPLAVSVLKELLTRRGDQEDESIHGFVERRLGK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZVN7-F1 | 74-161 | 97.80 | 94.56 | View in AlphaFoldDB ↗ |