DPCfam | MC120792
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 72 ± 12 aa |
| Residues in low-complexity regions (%) | 0.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.43 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02338 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 16.6 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A182EDM4 | 61-120 | 60 | IYLPLECPSNQCHRSPLVLCYDSAHFSALVTMRHTASNSVQSIIPITDKNRNLLPLHFSV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B2RUR8-F1 | 328-396 | 98.67 | 92.61 | View in AlphaFoldDB ↗ |