DPCfam | MC12071
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 120 ± 18 aa |
| Residues in low-complexity regions (%) | 9.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.41 |
| Average transmembrane regions | 1.05 |
| Dominant Pfam architecture(s) | PF11317 |
| Sequences matching dominant architecture (%) | 98.25 |
| Average overlap percent | 91.52 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A089PCJ0 | 8-128 | 121 | DNDSVILSPSYRLPIFIILSGLFLLITPFHPWPTIVISSFGFFLLLQSFTLKLKFTKDDLIVMQLGNELRRFPFKNWIAWRIILP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7M082-F1 | 83-208 | 97.66 | 87.28 | View in AlphaFoldDB ↗ |