DPCfam | MC120681
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1051 |
|---|---|
| Mean domain length (aa) | 282 ± 26 aa |
| Residues in low-complexity regions (%) | 3.99 |
| Residues in coiled-coil regions (%) | 21.3 |
| Predicted disordered residues (%) | 24.69 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03755- PF08340 |
| Sequences matching dominant architecture (%) | 95.09 |
| Average overlap percent | 99.56 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I4C6P8 | 15-303 | 289 | SMTGFGRGRSASGEVEIITEIRAVNHRFLDLSVKLPRAFNVFEPAIRKTVTDSVHRGKFDIMVTRSAGKNGLVEVTLDESLATGY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O34441-F1 | 4-291 | 100.00 | 91.74 | View in AlphaFoldDB ↗ |