DPCfam | MC120653
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Residues in low-complexity regions (%) | 3.09 |
| Residues in coiled-coil regions (%) | 17.65 |
| Predicted disordered residues (%) | 36.12 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05873 |
| Sequences matching dominant architecture (%) | 88.0 |
| Average overlap percent | 30.93 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1J8Q7H7 | 93-163 | 71 | ETFEAKAVEKAQATAAQIDVELNELQSTLANIEEARPFEDLTVEDVGNAHPRILEAVETMVQKGKWTVPGM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0C2C8-F1 | 100-173 | 100.00 | 89.21 | View in AlphaFoldDB ↗ |