DPCfam | MC120626
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Residues in low-complexity regions (%) | 0.35 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.3 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01749 |
| Sequences matching dominant architecture (%) | 0.92 |
| Average overlap percent | 2.63 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B4HDM9 | 58-123 | 66 | QRGKDKGTPFRLQLSEWLRNKPDNLVEWLLVPCPVGKRCMVIATNGKTKVYNKAGKQFMTLQEILQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3P7DHD8-F1 | 1163-1225 | 98.44 | 88.57 | View in AlphaFoldDB ↗ |