DPCfam | MC120523
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 60 ± 11 aa |
| Residues in low-complexity regions (%) | 2.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 1.0 |
| Average transmembrane regions | 0.8 |
| Dominant Pfam architecture(s) | PF14992 |
| Sequences matching dominant architecture (%) | 88.0 |
| Average overlap percent | 48.28 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q80X59 | 239-307 | 69 | FWLRHFRYLFFMVMIVIRLLGYVFFHLQYVNPDFLVDTLPMLMSRSSLKWLRDILFPFLTLEVEDVLPH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q80X59-F1 | 236-307 | 100.00 | 77.30 | View in AlphaFoldDB ↗ |