DPCfam | MC120352
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Residues in low-complexity regions (%) | 1.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.83 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01656 |
| Sequences matching dominant architecture (%) | 71.01 |
| Average overlap percent | 19.45 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P9I2H0 | 180-249 | 70 | FKKIYLIGNRFAPEMETTLREEAEKIGIEFAGIVPHDDDISRNNLAGQPLLDLSNESPALTAVTDILKRI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58098-F1 | 183-248 | 100.00 | 95.88 | View in AlphaFoldDB ↗ |