DPCfam | MC120197
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 243 ± 43 aa |
| Residues in low-complexity regions (%) | 1.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.61 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06466 |
| Sequences matching dominant architecture (%) | 95.52 |
| Average overlap percent | 85.77 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J9JWJ9 | 48-326 | 279 | RHEKLVKLSSKSSCQISTCQCSGWRGRSDNGLMTSICTKSGCNHPLSSHVSHLESAKDEQLNSLLALVFDLDNLSVIINQEKKKT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q92830-F1 | 100-362 | 99.60 | 89.76 | View in AlphaFoldDB ↗ |