DPCfam | MC120010
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 62 ± 6 aa |
| Residues in low-complexity regions (%) | 0.0 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12068 |
| Sequences matching dominant architecture (%) | 2.08 |
| Average overlap percent | 27.15 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A2A4691 | 105-175 | 71 | EEIQKVFNVDLSEMKSLLLFYDSDKRTSGQFVIGNYENHYKVFNFPIGGLEKITEILESWEWCASQKVNDD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8TBP0-F1 | 296-363 | 100.00 | 77.42 | View in AlphaFoldDB ↗ |