DPCfam | MC119889
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 163 ± 20 aa |
| Residues in low-complexity regions (%) | 4.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.54 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07248 |
| Sequences matching dominant architecture (%) | 98.72 |
| Average overlap percent | 92.82 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B4MRG8 | 38-207 | 170 | RSMWQPPCHPHEQPHCTDLLPRFDDIYYKPSEKCRCYQRTWIECPNIRLRMKKVCCLDGIEPPEVLYRYKARCPKVACELDYERM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8T8W0-F1 | 126-291 | 98.83 | 77.18 | View in AlphaFoldDB ↗ |