DPCfam | MC119837
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Residues in low-complexity regions (%) | 14.28 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.88 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF01888 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 33.25 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F9MSK4 | 8-91 | 84 | IQDGQKLRLGYTTGSCAVGATTAACLMLKSGQEIDQVNILTPAGIELQLDVCDITRGEDWVKCCIVKDAGDDPDATDGLSIYAE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C3L308-F1 | 11-92 | 97.62 | 95.41 | View in AlphaFoldDB ↗ |