DPCfam | MC119335
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Residues in low-complexity regions (%) | 1.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.08 |
| Average transmembrane regions | 0.17 |
| Dominant Pfam architecture(s) | PF02460 |
| Sequences matching dominant architecture (%) | 90.08 |
| Average overlap percent | 18.9 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009E3DF10 | 937-1064 | 128 | KDCTTCFHQSDLHDGRPSTAQFREKLPWFLKASPSANCAKGGSGIYSSSIDLTGFDSGMIQASSFRTYHSPLSGQMDYVNAMRAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8Q2J0-F1 | 974-1102 | 98.47 | 87.96 | View in AlphaFoldDB ↗ |