DPCfam | MC119276
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 413 ± 87 aa |
| Residues in low-complexity regions (%) | 3.71 |
| Residues in coiled-coil regions (%) | 0.16 |
| Predicted disordered residues (%) | 17.63 |
| Average transmembrane regions | 0.17 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S9TV02 | 7-535 | 529 | ISWVFTALVPVPLPPDATVPPLEGRTVARFYTEDRFPPARDGAADVQVELLECIYFLMLSLANAWQAVETPTRSYDAERCLMAMT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4DKH5-F1 | 928-1365 | 98.97 | 84.08 | View in AlphaFoldDB ↗ |