DPCfam | MC119109
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 464 ± 53 aa |
| Residues in low-complexity regions (%) | 11.12 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 57.87 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13922 |
| Sequences matching dominant architecture (%) | 96.55 |
| Average overlap percent | 9.64 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007F86F29 | 744-1170 | 426 | GSGSLTRTSSCIPANNPLVTQLLQGKEVPLEQILPKPLSKPEVKVSNLPAQPSVSKAKTSHPVELKVERPVSQQVNTGGRAGVFS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5ZM88-F1 | 918-1412 | 98.32 | 43.80 | View in AlphaFoldDB ↗ |