DPCfam | MC118757
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 79 ± 13 aa |
| Residues in low-complexity regions (%) | 4.76 |
| Residues in coiled-coil regions (%) | 0.12 |
| Predicted disordered residues (%) | 2.83 |
| Average transmembrane regions | 1.05 |
| Dominant Pfam architecture(s) | PF08449 |
| Sequences matching dominant architecture (%) | 98.43 |
| Average overlap percent | 31.64 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W4XLL0 | 229-316 | 88 | GLSMLTFALVLSARMGIFQEILYKEHGKHPREALFYSHALPLPGFLLMGRDIYHHAVMYSASEPIMIGLGISLPKMWLYLLGNML... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7ZW46-F1 | 163-244 | 98.80 | 90.74 | View in AlphaFoldDB ↗ |