DPCfam | MC118479
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1531 |
|---|---|
| Mean domain length (aa) | 144 ± 28 aa |
| Residues in low-complexity regions (%) | 2.47 |
| Residues in coiled-coil regions (%) | 0.11 |
| Predicted disordered residues (%) | 38.13 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14303 |
| Sequences matching dominant architecture (%) | 36.07 |
| Average overlap percent | 26.18 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D3AKZ5 | 118-275 | 158 | DPHLDDQVLISAWLNTSKDPVVGNEQRSRAFWQRIAVYFAASPKIGASERTESSHCKQRWHKINDQVGKFCGAFEAASRERTSGQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9STU5-F1 | 46-198 | 97.37 | 80.11 | View in AlphaFoldDB ↗ |